Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB017422.1 | 5prime_partial | 204 | 2-616(+) |
Amino Acid sequence : | |||
CLGESSTRMGDLLGSPRVAPPEISFFYFFPSSVPFFSRPILHPRVGPTRGRGADGDRLLKLLFHVTDSHRSARLRCHVVLSGSRSWRCRQIRGKTSAGTRIVPKLQRAVTFATVVRTARI TYVFGAARRAGRDGQCAGGTLPPSRIPKFPSFRPPKRCFFTEISFACRSFVKDLTLRCWVCYFGSRACPEVPYSWNSSAAPLPV* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,726.157 | ||
Theoretical pI: | 11.195 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22960 | ||
Instability index: | 62.340 | ||
aromaticity | 0.113 | ||
GRAVY | -0.142 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.279 | ||
sheet | 0.172 |