Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB017423.1 | 5prime_partial | 204 | 2-616(+) |
Amino Acid sequence : | |||
CLGESSTRMGDLLGSPRVAPPEISFFYFFPSSDPFFSRPILHPRVGPSRGRGADGDRLLKLLFHLTDSYRSARLRCHVVLSGHRSWRCRQIRGKTSAGTRIVPKLQRAVTSATVVRTARI TYVFGAARRAGRDGQCAGGTLPPSRIPKFPSFRPPKRCFFPEISFACRSFVKDLTLRCWVCYFGSRACPEVPYSWNSSAAPLPV* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,754.124 | ||
Theoretical pI: | 10.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24450 | ||
Instability index: | 62.174 | ||
aromaticity | 0.113 | ||
GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.289 | ||
sheet | 0.176 |