Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB436791.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
EILEAIAKFLNLNITPCLPLRGTITASGDLVPLSYIAGVLLGRPNSKAIGPNGEVLDAGQALTLAGVPSFFELQPKEGLALVNGTAVGSGLASIVLFEANILAILTNVTSALFAEVMQGK PEFTDHLTHKLKHHPGQIESAAIME | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,121.378 | ||
Theoretical pI: | 5.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 30.712 | ||
aromaticity | 0.048 | ||
GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.262 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB436791.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
EILEAIAKFLNLNITPCLPLRGTITASGDLVPLSYIAGVLLGRPNSKAIGPNGEVLDAGQALTLAGVPSFFELQPKEGLALVNGTAVGSGLASIVLFEANILAILTNVTSALFAEVMQGK PEFTDHLTHKLKHHPGQIESAAIME | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,121.378 | ||
Theoretical pI: | 5.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 30.712 | ||
aromaticity | 0.048 | ||
GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.262 | ||
sheet | 0.352 |