Acc_NO	ORF type	length	start-end position (strand +/-)
>AB492067.1	complete	236	23-733(+)
Amino Acid sequence :
MAGMERLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPG FGCWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKRMDRWIDPPAV*
Physicochemical properties
Number of amino acids:		236
Molecular weight:		14,181.248
Theoretical pI:		9.206
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29450
Instability index:		58.149
aromaticity		0.125
GRAVY		-0.147
Secondary Structure Fraction
Helix		0.392
turn		0.258
sheet		0.192

Acc_NO	ORF type	length	start-end position (strand +/-)
>AB492067.1	5prime_partial	120	733-371(-)
Amino Acid sequence :
SNRWRVNPSVHSFVKIEEHLLLKFILPVIYGYGVIMPIQPMNQSLDRWFVKVSHIGSSLPWFLTEHHGLRVNETESINYHLPFDTLNWIYHHSYCPLIQSFETLLSVNIHTRKPTSKARM *
Physicochemical properties
Number of amino acids:		120
Molecular weight:		14,181.248
Theoretical pI:		9.206
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29450
Instability index:		58.149
aromaticity		0.125
GRAVY		-0.147
Secondary Structure Fraction
Helix		0.392
turn		0.258
sheet		0.192