Acc_NO	ORF type	length	start-end position (strand +/-)
>AB492069.1	complete	131	152-547(+)
Amino Acid sequence :
MRNPTTLDRIIGMLAGLFQCFFWVLKMEKAGVGYQNTVIFGLTKPKNLPQELTRMMDPCTTSIEECDVLHERNVSSKYNALTLLALFGLDHSSVGKMLEPSISMLGSRSKEGSDPSFPKR RLCLTELSYRN*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,764.079
Theoretical pI:		8.748
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		49.595
aromaticity		0.076
GRAVY		-0.173
Secondary Structure Fraction
Helix		0.298
turn		0.260
sheet		0.282