Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB492078.1 | 3prime_partial | 235 | 57-761(+) |
Amino Acid sequence : | |||
MAAAAVVSNGDYAAVQTPSAGRYAAGYSEVQNSRLDHSLPLPSVLKTSLKVVDGPPSSSAGNPDEIAKLFPCLFGQPSVNMVPADATNELLPQALKIGVVLSGGQAPGGHNVISGIFDYL QDRCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFQQAADTAVKLDLDGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKSKE | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 24,799.841 | ||
Theoretical pI: | 5.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
Instability index: | 33.799 | ||
aromaticity | 0.068 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.302 | ||
sheet | 0.230 |