| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492079.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
| EARVAGTGSAAYAAFSNRISAAVILRGYQTYITACPFKKMSNVLANKTIRKLAHSATTLHIIDFGILYGFQWPCLIQALSERPGGPPQLRITGIDFPQPGFRPAERVADTGDRLARYCQR FGVPFEYNAIAQKWESIKVEDLRIEPGELLVVNSQYRLQNVPDETVVVSSPRDAVLKLIKRINPDMFLLGVVNGTYNTPFFVTRFREALFQYSSLFDMYEATVPREDPNRLLFEEEXFGK GRHQHHRVRGDGAARPPR | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 12,895.527 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 87.855 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.333 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492079.1 | 5prime_partial | 191 | 774-199(-) |
Amino Acid sequence : | |||
| SGRSSRSVPSHAMMLVASFPEXLLLEEQPVGVLPGHGGLVHVEQRRVLEQRLPESRHEEGRVVGPVHHPKEEHVRVDPLDQLQHRVPRAADDDRLVRDVLQPVLRVHDKELARLDPEVLD LDALPFLRDGIVLERDSEPLAVSSQTVARVGHPLGRAEARLREVDAGDAELRGPAGPLGESLDQAGPLESI* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 12,895.527 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 87.855 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.333 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492079.1 | 3prime_partial | 125 | 399-773(+) |
Amino Acid sequence : | |||
| MGEHQGRGPQDRAGRAPCRELAVPAAERPGRDGRRQQPEGRGAEADQEDQPGHVPPWGGERDLQHALLRDAIPGGAVPVLVAVRHVRGHRAPGGPQPAALRGGXVRERTPPTSSRARGRS GSTAP | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,895.527 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 87.855 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.333 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492079.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| GTCSRHRLGRLRRLLQQDIGCGHLERLPNIHNGLPFQENVQRFSQQNHQKTRPFRNNPSHNRLRHIIWIPVALPDPSSLRAARRAPAAPHHRHRLPSAGLPPGRAGGRHGRPSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,895.527 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 87.855 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.333 | ||
| sheet | 0.193 | ||