Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB492081.1 | complete | 138 | 275-691(+) |
Amino Acid sequence : | |||
MADVPHHVRSCLQSGKLALLAILVSGGIVLQILACALYNNWWPMLTVIMYVLLPMPLLFFAGANASSLYSESSSGWIDATKFLTGASIVGSIAIPVILKHAGVIGWGALVMELSSFSIFG MAILCFLGTSSDDEYSMF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,734.308 | ||
Theoretical pI: | 5.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 46.070 | ||
aromaticity | 0.109 | ||
GRAVY | 0.955 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.268 | ||
sheet | 0.319 |