| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492082.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
| ELTRQYHHALDASVARNFPDNGCIACMSHNLESLYCSKQTGIVRASDDFYPRDPVSHTIHIAAVAYNSVFLGEIMLPDWDMFHSLHPAAEYHGSARAISGGPVYVSDAPGKHNFELLRKL VLPDGSILRPRLPGRPTKDCLFSDPARDGVSLLKIWNMNKHSGVLGVYNCQGAAWNSVERKNTFHQTKSEAITGYVRGRXXHLISDVAPDSNWDGNVALYSHRVGEVIVLPYNAAMPVSL KVLEHEVYTVTPVR | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,246.544 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 60.953 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.306 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492082.1 | complete | 108 | 475-149(-) |
Amino Acid sequence : | |||
| MFHIFSKLTPSRAGSEKRQSFVGRPGRRGRRMEPSGKTSFLRSSKLCFPGASLTYTGPPLIALAEPWYSAAGCREWNMSQSGNIISPKNTLLYATAAMWMVCDTGSRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,246.544 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 60.953 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.306 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492082.1 | 5prime_partial | 101 | 764-459(-) |
Amino Acid sequence : | |||
| SDGCHGVDLVLEDLEGDGHGRVVGEDDHLAHAVGVEGHVAVPVGVGRHVGDEVXXPATDVARDRLGFRLVEGVLPLDAVPRCALAVVNSQHPTVFVHVPYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,246.544 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 60.953 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.306 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB492082.1 | 3prime_partial | 99 | 467-763(+) |
Amino Acid sequence : | |||
| MEHEQTQWGVGSLQLPGRSVEQRREEEHLPPDEIRGDHGLRPWPGXPPHLRRGARLQLGRQRGPLLPPRGRGDRPPLQRGHARLPQGPRARGLHRDTRQ | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,246.544 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 60.953 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.306 | ||
| sheet | 0.235 | ||