Acc_NO	ORF type	length	start-end position (strand +/-)
>AB492083.1	internal	236	3-710(+)
Amino Acid sequence :
FANHGHVILADPSPILFYPISSSEIRCLVDVPGEKVPSISNGEMAKYLKTVIAPQVPPELHGAFLSAIERGNMRTMPNRSMPAAPHPTPGALLMGDAFNMRHPLTGGGMTVALSDIVVLR NLLRPLKDLNDASTLCKYLESFYTLRKPVASTINTLAGALYKVFSASPDQARNEMRQACFDYLSLGGVFSSGPVSLLSGLNPRPLSLVCHFFAVAIYGVGRLLLPFPSPKRMWIGA
Physicochemical properties
Number of amino acids:		236
Molecular weight:		25,504.549
Theoretical pI:		9.276
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16180
Instability index:		49.342
aromaticity		0.081
GRAVY		0.180
Secondary Structure Fraction
Helix		0.322
turn		0.305
sheet		0.284