Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB514199.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
KGMSYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARRGGKIWVRLFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIAKRAILIAASKMPIRTQFIISG* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,147.315 | ||
Theoretical pI: | 10.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 58.119 | ||
aromaticity | 0.085 | ||
GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.246 | ||
sheet | 0.237 |