Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 200 | 1-603(+) |
Amino Acid sequence : | |||
SAAGSSSWIRCDLRNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW EAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPD* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 195 | 603-16(-) |
Amino Acid sequence : | |||
LIGNEIAIVVLEALRQSTPLSIQRLQFHKQRIVLTLEPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGSLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLP GENIEHNIASSRSELHPLRVEDLLRVVRRRNDDEVALPHAEEENIAEFLRVIGEIPVVEIIADLKPVPKIAPNPA* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
PRQEVQAGFGAIFGTGFRSAMISTTGISPITRRNSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGWSSDRELAMLCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 200 | 1-603(+) |
Amino Acid sequence : | |||
SAAGSSSWIRCDLRNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW EAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPD* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 195 | 603-16(-) |
Amino Acid sequence : | |||
LIGNEIAIVVLEALRQSTPLSIQRLQFHKQRIVLTLEPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGSLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLP GENIEHNIASSRSELHPLRVEDLLRVVRRRNDDEVALPHAEEENIAEFLRVIGEIPVVEIIADLKPVPKIAPNPA* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB677830.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
PRQEVQAGFGAIFGTGFRSAMISTTGISPITRRNSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGWSSDRELAMLCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,978.162 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 76.341 | ||
aromaticity | 0.098 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.373 | ||
sheet | 0.137 |