| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 200 | 1-603(+) |
Amino Acid sequence : | |||
| SAAGSSSWIRCDLRNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW EAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 195 | 603-16(-) |
Amino Acid sequence : | |||
| LIGNEIAIVVLEALRQSTPLSIQRLQFHKQRIVLTLEPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGSLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLP GENIEHNIASSRSELHPLRVEDLLRVVRRRNDDEVALPHAEEENIAEFLRVIGEIPVVEIIADLKPVPKIAPNPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
| PRQEVQAGFGAIFGTGFRSAMISTTGISPITRRNSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGWSSDRELAMLCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 200 | 1-603(+) |
Amino Acid sequence : | |||
| SAAGSSSWIRCDLRNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGW EAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 195 | 603-16(-) |
Amino Acid sequence : | |||
| LIGNEIAIVVLEALRQSTPLSIQRLQFHKQRIVLTLEPSIEHNPIHVVVHHQLQAPPQHDPVRRRLRILLHVIHDGGSLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLP GENIEHNIASSRSELHPLRVEDLLRVVRRRNDDEVALPHAEEENIAEFLRVIGEIPVVEIIADLKPVPKIAPNPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AB677830.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
| PRQEVQAGFGAIFGTGFRSAMISTTGISPITRRNSAIFSSSAWGSATSSSFRRRTTRRRSSTRRGWSSDRELAMLCSIFSPGRGRTWCSPFTASTGGRCGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,978.162 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 76.341 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.373 | ||
| sheet | 0.137 | ||