Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AB925416.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
VKEYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLE DLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,710.142 | ||
Theoretical pI: | 6.186 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 30.127 | ||
aromaticity | 0.119 | ||
GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.226 | ||
sheet | 0.254 |