Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AF000375.1 | complete | 200 | 43-645(+) |
Amino Acid sequence : | |||
METPSYDIKNKGDDVQEKTKLKHEKEGDERGKIIEQETPSQDINNKDITSSYGIRDDAQQKPKVEHEEGGNEKEKIIEKETLSQCIIKMEGDDAQEKLNVEYEEEECVKEKIVEKETPSQ DISNKGDDAQEKPKVEHEEDGDEKETPSQDISKIEGEDAQEIPKVECEEKKIIVKVDLAVRSTPPPKRDPPKMQTDNNKI* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,844.875 | ||
Theoretical pI: | 4.610 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 53.650 | ||
aromaticity | 0.015 | ||
GRAVY | -1.458 | ||
Secondary Structure Fraction | |||
Helix | 0.175 | ||
turn | 0.200 | ||
sheet | 0.240 |