Acc_NO	ORF type	length	start-end position (strand +/-)
>AF283464.1	5prime_partial	181	1-546(+)
Amino Acid sequence :
PVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGGIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADNSY FKIVKSSKIGYNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALVNENPLDVNFKEV*
Physicochemical properties
Number of amino acids:		181
Molecular weight:		19,756.457
Theoretical pI:		8.601
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16305
Instability index:		20.960
aromaticity		0.094
GRAVY		-0.040
Secondary Structure Fraction
Helix		0.348
turn		0.326
sheet		0.166