Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AF283464.1 | 5prime_partial | 181 | 1-546(+) |
Amino Acid sequence : | |||
PVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGGIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADNSY FKIVKSSKIGYNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALVNENPLDVNFKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 19,756.457 | ||
Theoretical pI: | 8.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16305 | ||
Instability index: | 20.960 | ||
aromaticity | 0.094 | ||
GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.326 | ||
sheet | 0.166 |