| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AF347116.1 | internal | 287 | 3-863(+) |
Amino Acid sequence : | |||
| GKVPSPLLSPPRPPPGRSARLPSRQQRPPDRRRPPHRQPALLRIGRLRDARRLQLGSVQRGRRLPIQHPRARSRLHPHAQQPRPARNPQRQLQHPRLGLPPQHQHRPGQLRRRPRSRPAR HHLRARHLVHTRPQPSRTRRYRVKYPPGAERALLVAGDVRQRAAGDERLQPGHEGRLQPGSHQREXNQHRVGVGDFGQGAALLHEARAHRADRDQRRPPQHRVAQQHRRAGRGLRSHSPD QRAGGRLRTRRLVHRFFGFGCPLICAXYXXXYLNXXXXYPLVPXXVQ | |||
Physicochemical properties | |||
| Number of amino acids: | 287 | ||
| Molecular weight: | 11,956.669 | ||
| Theoretical pI: | 11.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34490 | ||
| Instability index: | 65.172 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.623 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.214 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AF347116.1 | complete | 263 | 1-792(+) |
Amino Acid sequence : | |||
| MAKSLVLSSLLLALLLAAPLASLADNNVLLTGDVLHTDNQLSFESAAFVMQGDCNLVLYNEAGGFQSNTHGRGVGCTLTLNNLGQLEIHSANSNTPVWVSPRNINTVQGNYAAVLGPDQH VTIYGPAIWSTPAPNRHERGATVSNIPRVRNVLFSSQVMSDNAQLATRDYSLVMRDDCNLALTKGSXTNIVWESGTSGRGQHCFMRLGHTGLIEISDDRLNTVWRSNTVGQEGDYVLILQ INGQAVVYGPAVWSTASSASGAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 11,956.669 | ||
| Theoretical pI: | 11.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34490 | ||
| Instability index: | 65.172 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.623 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.214 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AF347116.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
| MLRGETQTGVLELALWISSWPRLLSVRVQPTPRPWVLDWKPPASLYRTKLQSPCITKAADSKESWLSVWRTSPVRRTLLSAREASGAARRRARRREERTRDFA | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,956.669 | ||
| Theoretical pI: | 11.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34490 | ||
| Instability index: | 65.172 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.623 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.214 | ||
| sheet | 0.282 | ||