Acc_NO	ORF type	length	start-end position (strand +/-)
>AF421898.1	internal	477	1-1431(+)
Amino Acid sequence :
ELWAVEGFLNEEEGKSIEEVAETCINELIDRSLIFIHNLSFDGTIKSCGMHDVTRELCLREARNMNFVRVLRGKSDQSSSTQSMQCSFKSRSRISIHNEEELVQCRNSEAHSIIMLSRFK CVALELSFKLVRVLDLSFTQCPCFPSGILSSIHLRYLALGFYPCLQQYRGSKEAVPSSLIDIPLSISSLCYLKTFKLYPPYNIRYKYPFLLPSEILTMPQLRKLCLGWNYLRNPKKSYTT ENSLVSKNLQCLSGLNPRYCTGSFFRLFPNLKELRVFGIPEDFRNRKDLYDFRCLYQLEKLEFRIVYPFAVYFLNGITPQEPLRFLKEILLEETEFGGIGTPTGVPTLLLPPPDVFPQNL KNLTFNGNFSGAWKNLSIVGKLPKLDVLKLSNTAFVGEKWEVVEEGFPCLKFLLLDSVYIRYWRASSDHFPCLERLFLKDCFALDSIPRDFADITTLALIDICKCRQSVGNSAKQIQ
Physicochemical properties
Number of amino acids:		477
Molecular weight:		11,734.514
Theoretical pI:		10.909
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		55.301
aromaticity		0.093
GRAVY		-0.404
Secondary Structure Fraction
Helix		0.250
turn		0.389
sheet		0.139

Acc_NO	ORF type	length	start-end position (strand +/-)
>AF421898.1	complete	108	1259-933(-)
Amino Acid sequence :
MYTESRSKNFKHGKPSSTTSHFSPTKAVFDSLRTSSLGNLPTMLKFFHAPEKFPLKVKFLRFCGKTSGGGKSKVGTPVGVPIPPNSVSSSNISFRNLRGSCGVMPLRK*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		11,734.514
Theoretical pI:		10.909
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		55.301
aromaticity		0.093
GRAVY		-0.404
Secondary Structure Fraction
Helix		0.250
turn		0.389
sheet		0.139