Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AF450276.1 | complete | 247 | 1-744(+) |
Amino Acid sequence : | |||
MGYSRSSFVFFLLTFVTYTYATSFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTSMAXIWGRTNCNFDGAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFSNLDFWDIS LVDGFNIPMTFAPTNPSGGKCHSIQCTANINGECPAALRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVFCPNGVTSPNFPLEMPS STDEVAK* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 11,084.884 | ||
Theoretical pI: | 11.659 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 73.379 | ||
aromaticity | 0.082 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.276 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AF450276.1 | complete | 99 | 356-57(-) |
Amino Acid sequence : | |||
MSQKSRLLNWFKAYSARVFGGLPHPVHCRTPPQSPVWHEPLPAPSKLQLVRPHXRAILVPLGALMTHVWPRSRRRPPPIGVDAAHTVYGQLFRTSKEVA* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,084.884 | ||
Theoretical pI: | 11.659 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 73.379 | ||
aromaticity | 0.082 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.276 | ||
sheet | 0.224 |