Acc_NO	ORF type	length	start-end position (strand +/-)
>AF450277.1	internal	207	1-621(+)
Amino Acid sequence :
ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGSCQTGDCGGVLRCTGWGKPPNTLAEYALDQFGNLDFWDISLVDGFNIPMTFAPTKPSGGKC HAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPKG
Physicochemical properties
Number of amino acids:		207
Molecular weight:		12,176.006
Theoretical pI:		11.437
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		50.848
aromaticity		0.084
GRAVY		-0.211
Secondary Structure Fraction
Helix		0.290
turn		0.206
sheet		0.187

Acc_NO	ORF type	length	start-end position (strand +/-)
>AF450277.1	5prime_partial	107	621-298(-)
Amino Acid sequence :
TLRTKDNPIVCTTSRTSKCASRIILWVAIRIRTSFLEKFRQLRRTTWTLGATILLSSERGTRVVTSSRYLKGARTFTIYIGRAMNCMAFPTTRFGGGESHRNIESID*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,176.006
Theoretical pI:		11.437
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		50.848
aromaticity		0.084
GRAVY		-0.211
Secondary Structure Fraction
Helix		0.290
turn		0.206
sheet		0.187