Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ000253.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
FNTTPFDPAGGGDPILYQHPPWFLGHPEVYILIPPGFGIISHIVSTFSGKPVFGYLGMVYAMISTGVLGFLVWAHHMFTVGLDVDTRAHSTAATMIIAVPTGIKIFSWIATMWGGSIRYK TPMPSAVGSIFLSTIGGPTGIVPANPGLDIALHDTHYVVAHPHYVLPMGAVFASFAGFYSRVGKISGRTYPETSGQIHFRITFVGVNLTLFPMHFS | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 23,308.824 | ||
Theoretical pI: | 8.237 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
Instability index: | 26.075 | ||
aromaticity | 0.139 | ||
GRAVY | 0.473 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.292 | ||
sheet | 0.176 |