Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ006146.1 | 5prime_partial | 165 | 1-498(+) |
Amino Acid sequence : | |||
APPQFQQASHLSKNKSLFLVGAEQSKNEPNKMIVHEWLFLTIAPCDAAEPWQLGFQDAATPMMQGITDLHHDIFFFLILILVFVLWMLVRALWHFDYKKHPIPQRIVHGTTIEILRTILP SIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRSAPQHER* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 16,471.123 | ||
Theoretical pI: | 5.122 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 43.528 | ||
aromaticity | 0.095 | ||
GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.277 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ006146.1 | complete | 148 | 872-1318(+) |
Amino Acid sequence : | |||
MWKACCGETSQVKFGGRQASTQPYEYSDYNSSDEQSLTFDSYMITEDDLELGQSRLLEVDNRVVLPANTHLRMIVTSADVPHSWAVPSSGVKCHAVPGRSNQTSISVQREGVYYGQCSRF CGTNHASMPIVVEAVSMKDYGSWVQNFE* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,471.123 | ||
Theoretical pI: | 5.122 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 43.528 | ||
aromaticity | 0.095 | ||
GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.277 | ||
sheet | 0.196 |