Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ290641.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
HMCVDYRQLNKLTIKNKYPLPRIDDLFDQVNGATMFSKIDLRTGYHQLRIKYEDISKTTFRTQYGHYEFVVLPFGLTNAPATFMCLMNSVLNKYLDNFLLLFIDDILIY* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,924.906 | ||
Theoretical pI: | 7.949 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 27.414 | ||
aromaticity | 0.147 | ||
GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.165 | ||
sheet | 0.220 |