Acc_NO	ORF type	length	start-end position (strand +/-)
>AJ312673.1	internal	339	1-1017(+)
Amino Acid sequence :
SDSGKDAGRLSAAWQLYKAQEDMMKVAKKYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPGTINGSIRVTIQGEVIEQSCGEERLCFKTLLDEMAVVATKEYRSIVFQEPRFVEYFRLAT PETEYGKMNIGGRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGVGAAFKHIMEKDKKNFQTLREMYNVWPFFRVTIDLLEMVFAKGNPDIAALYDKLLVSEDLQPFGERLRNNYVE TKSLLLQVAGHKDLLEGDPYLKQRLRLRNAYITTLNVCQAYTLKRIRDPTYNVNLRPRLSKDVTERRKPAAEFLTLNPTSEYAPGLEDTLILTMKGIAA
Physicochemical properties
Number of amino acids:		339
Molecular weight:		11,745.681
Theoretical pI:		10.784
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		42.384
aromaticity		0.132
GRAVY		0.249
Secondary Structure Fraction
Helix		0.368
turn		0.330
sheet		0.189

Acc_NO	ORF type	length	start-end position (strand +/-)
>AJ312673.1	5prime_partial	112	1017-679(-)
Amino Acid sequence :
CGNAFHGKDQRVLKPRRVLAGGVQRQELSCRLSPLGHVLGEARPQVHVVGWISDALQSVCLAHVQGCYVGVTQAKSLFQIRVPFKKILVSGDLEEEAFCLNIVVSESLTKWL*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		11,745.681
Theoretical pI:		10.784
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		42.384
aromaticity		0.132
GRAVY		0.249
Secondary Structure Fraction
Helix		0.368
turn		0.330
sheet		0.189

Acc_NO	ORF type	length	start-end position (strand +/-)
>AJ312673.1	complete	106	641-321(-)
Amino Acid sequence :
MSGFPFAKTISSKSIVTLKNGHTLYISLSVWKFFLSFSMICLNAAPTPSQTGRWNLVWVHANIHGIARKLSIPPLGFLFDGLPPMFILPYSVSGVARRKYSTNRGS*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,745.681
Theoretical pI:		10.784
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		42.384
aromaticity		0.132
GRAVY		0.249
Secondary Structure Fraction
Helix		0.368
turn		0.330
sheet		0.189