Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ312674.1 | internal | 364 | 1-1092(+) |
Amino Acid sequence : | |||
SDSGKDAGRLSAAWQLYKAQEDMMKVAKKYGVKLTMFHGRGGTVGRRGGPTHLAILSQPPGTINGSIRVTIQGEVIEQSFGEERLCFKTLQRYTAATLEHGMNPAISPKPEWRALLDEMA VVATKEYRSIVFQEPRFVEYFRLATPETEYGKMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGVGAAFKHVMEKDKKNFQTLREMYNVWPFFRVTIDLLEMVFAKGNPDIA ALYDKLLVSEDLQPFGERLRNNYVETKSLLLQVAGHKDLLEGDPYLKQRLRLRNAYITTLNVCQAYTLKRIRDPTYNVNLRPRLSKDVTERRKPAAEFLTLNPTSEYAPGLEDTLILTMK GIAA | |||
Physicochemical properties | |||
Number of amino acids: | 364 | ||
Molecular weight: | 11,749.670 | ||
Theoretical pI: | 10.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 40.295 | ||
aromaticity | 0.132 | ||
GRAVY | 0.251 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.321 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ312674.1 | 5prime_partial | 112 | 1092-754(-) |
Amino Acid sequence : | |||
CGNAFHGKDQRVLKPRRVLAGWVQRQELSSRLSPLGHVLGEAGPQVHVVGGISDAFQSVCLAHVQGCYVGVTQAKSLLQIRVPFKEILVPGDLQKEALCFNIVVSESLTKWL* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,749.670 | ||
Theoretical pI: | 10.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 40.295 | ||
aromaticity | 0.132 | ||
GRAVY | 0.251 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.321 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ312674.1 | complete | 106 | 716-396(-) |
Amino Acid sequence : | |||
MSGFPFAKTISSKSIVTLKNGHTLYISLSVWKFFLSFSMTCLNAAPTPSQTGRWNLVWVHANIHGIARKLSIPPLGFLFDGLLPMFILPYSVSGVARRKYSTNRGS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,749.670 | ||
Theoretical pI: | 10.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 40.295 | ||
aromaticity | 0.132 | ||
GRAVY | 0.251 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.321 | ||
sheet | 0.198 |