Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | complete | 305 | 1-918(+) |
Amino Acid sequence : | |||
MSAKISPSATTLAASFRRPPSGARIILLSSLPVRRPVERRIRPPLLHRRRRTATVFFVLAEEKTTPFLDDVEEEKSIAPSNRAAERSARKRSERTTYLITAVMSSFGITSMAAAAVYYRF AWQMEGGDVPVTEMAGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLNFGFFHRGLLPGLCFGAGLGITLFGIAYMFVHDGLVHRRFPVG PIADVPYFQRVAAAHQIHHSEKFEGVPYGLFMGPKELEEIGGLKELEKEVSRRIKAYNNSAEIKT* | |||
Physicochemical properties | |||
Number of amino acids: | 305 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
CRPKSPPPPPPSPPPSAALRPAHASSSSLRSLSAAPSNVESGRRCFIVGVGRRQCFSFSPKKKQLLFLTMWRKRRVLRRQIGRLRGRRGSGRSGPRTSSRRLCRASASHPWPPPPSTTAS LGKWREGMCQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | complete | 124 | 725-351(-) |
Amino Acid sequence : | |||
MGPTGNRRWTSPSWTNMYAIPNSVIPSPAPKQRPGRRPLWKKPKLRRAMAGTALIMAKTSLSSKGPSLGRWWDSCMCQSDACQSARWAHLAQNSIPTAAPTERANVPAISVTGTSPPSIC QAKR* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | complete | 305 | 1-918(+) |
Amino Acid sequence : | |||
MSAKISPSATTLAASFRRPPSGARIILLSSLPVRRPVERRIRPPLLHRRRRTATVFFVLAEEKTTPFLDDVEEEKSIAPSNRAAERSARKRSERTTYLITAVMSSFGITSMAAAAVYYRF AWQMEGGDVPVTEMAGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLNFGFFHRGLLPGLCFGAGLGITLFGIAYMFVHDGLVHRRFPVG PIADVPYFQRVAAAHQIHHSEKFEGVPYGLFMGPKELEEIGGLKELEKEVSRRIKAYNNSAEIKT* | |||
Physicochemical properties | |||
Number of amino acids: | 305 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
CRPKSPPPPPPSPPPSAALRPAHASSSSLRSLSAAPSNVESGRRCFIVGVGRRQCFSFSPKKKQLLFLTMWRKRRVLRRQIGRLRGRRGSGRSGPRTSSRRLCRASASHPWPPPPSTTAS LGKWREGMCQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416711.2 | complete | 124 | 725-351(-) |
Amino Acid sequence : | |||
MGPTGNRRWTSPSWTNMYAIPNSVIPSPAPKQRPGRRPLWKKPKLRRAMAGTALIMAKTSLSSKGPSLGRWWDSCMCQSDACQSARWAHLAQNSIPTAAPTERANVPAISVTGTSPPSIC QAKR* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,483.470 | ||
Theoretical pI: | 11.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34740 | ||
Instability index: | 87.122 | ||
aromaticity | 0.056 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.177 | ||
turn | 0.339 | ||
sheet | 0.218 |