| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ416712.1 | internal | 218 | 655-2(-) |
Amino Acid sequence : | |||
| RGIMMHDFAITENYAIFMDLPLYFQPEEMVKGKFVSSFHPTKRARIGVLPRYAEDEHPIRWFDLPSCFMTHNANAWEENDEVVLFTCRLESPDLDMLSGPAEEEIGNSKSELYEMRFNLK TGITSQKQLSVPSVDFPRINQSYTGRKQQYVYCTLGNTKIKGIVKFDLQIEPEAGKTMLEVGGNVQGIFELGPRRYGSEAIFVPCQPGIKSDEDDGYV | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,864.979 | ||
| Theoretical pI: | 5.023 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
| Instability index: | 47.251 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.243 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ416712.1 | internal | 218 | 655-2(-) |
Amino Acid sequence : | |||
| RGIMMHDFAITENYAIFMDLPLYFQPEEMVKGKFVSSFHPTKRARIGVLPRYAEDEHPIRWFDLPSCFMTHNANAWEENDEVVLFTCRLESPDLDMLSGPAEEEIGNSKSELYEMRFNLK TGITSQKQLSVPSVDFPRINQSYTGRKQQYVYCTLGNTKIKGIVKFDLQIEPEAGKTMLEVGGNVQGIFELGPRRYGSEAIFVPCQPGIKSDEDDGYV | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,864.979 | ||
| Theoretical pI: | 5.023 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
| Instability index: | 47.251 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.243 | ||
| sheet | 0.239 | ||