Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416714.1 | internal | 209 | 629-3(-) |
Amino Acid sequence : | |||
RGIMMHDFAITEHYAVFPDIQIVMKPAEIVRGRRVIGPDHEKVSRLGLLPRYATSDSEMRWFDVPGFNMVHVVNAWEEEGGEVVVIVAPNVSPIENAIDRFDLLHVSVEMARIDLRSGSV SRTLLSAENLDFGVIHRGYSGRKSRYAYLGVGDPMPKIRGVVKVDFELAGRGECVVARREFGVGCFGGEPFFVPASSKKSGGEEDDGYV | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 16,539.122 | ||
Theoretical pI: | 11.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 81.745 | ||
aromaticity | 0.027 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.327 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416714.1 | 3prime_partial | 150 | 450-1(-) |
Amino Acid sequence : | |||
MVRRAGVQHGTRGERVGGGRWGGRGDRGAQREPDRERHRPVRPPPRVGGDGEDRSQERERVADASLGGESGFRGDSPGLFGEEEPVCLPRSRGSNAEDSRGGEGGLRVGRERGMRGGEEG VRCGMFRRRAVLCAGIIEEERRRGRRRLRN | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,539.122 | ||
Theoretical pI: | 11.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 81.745 | ||
aromaticity | 0.027 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.327 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416714.1 | internal | 209 | 629-3(-) |
Amino Acid sequence : | |||
RGIMMHDFAITEHYAVFPDIQIVMKPAEIVRGRRVIGPDHEKVSRLGLLPRYATSDSEMRWFDVPGFNMVHVVNAWEEEGGEVVVIVAPNVSPIENAIDRFDLLHVSVEMARIDLRSGSV SRTLLSAENLDFGVIHRGYSGRKSRYAYLGVGDPMPKIRGVVKVDFELAGRGECVVARREFGVGCFGGEPFFVPASSKKSGGEEDDGYV | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 16,539.122 | ||
Theoretical pI: | 11.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 81.745 | ||
aromaticity | 0.027 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.327 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AJ416714.1 | 3prime_partial | 150 | 450-1(-) |
Amino Acid sequence : | |||
MVRRAGVQHGTRGERVGGGRWGGRGDRGAQREPDRERHRPVRPPPRVGGDGEDRSQERERVADASLGGESGFRGDSPGLFGEEEPVCLPRSRGSNAEDSRGGEGGLRVGRERGMRGGEEG VRCGMFRRRAVLCAGIIEEERRRGRRRLRN | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,539.122 | ||
Theoretical pI: | 11.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 81.745 | ||
aromaticity | 0.027 | ||
GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
Helix | 0.147 | ||
turn | 0.327 | ||
sheet | 0.227 |