| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ416715.1 | internal | 163 | 490-2(-) |
Amino Acid sequence : | |||
| SHAPGRHGRGIFDGDGMGMNMVSKGVQNVLDYLQTDFPDMEVISISGNFCADKKPAAVNWIEGRGKSVVCEAVIKEETVKRVLKTTVPALVELNTMKNLVGSAVAGSLGGFNAHASNIVT AVFIATGQDPAQNVESSQCITLIESVNDGKDLHISVTIPSPSK | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,166.368 | ||
| Theoretical pI: | 5.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 33.700 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.288 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ416715.1 | internal | 163 | 490-2(-) |
Amino Acid sequence : | |||
| SHAPGRHGRGIFDGDGMGMNMVSKGVQNVLDYLQTDFPDMEVISISGNFCADKKPAAVNWIEGRGKSVVCEAVIKEETVKRVLKTTVPALVELNTMKNLVGSAVAGSLGGFNAHASNIVT AVFIATGQDPAQNVESSQCITLIESVNDGKDLHISVTIPSPSK | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,166.368 | ||
| Theoretical pI: | 5.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 33.700 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.288 | ||
| sheet | 0.215 | ||