| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489274.1 | internal | 126 | 1-378(+) |
Amino Acid sequence : | |||
| VSNCYWNWGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSAT LFNKGS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,703.836 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28460 | ||
| Instability index: | 48.920 | ||
| aromaticity | 0.186 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.257 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489274.1 | 5prime_partial | 113 | 378-37(-) |
Amino Acid sequence : | |||
| RPFIEKGSRINCNFLPHIPVRMFQCISNFHFFQLFNRPISECPSRCRQNNASECTLWQTLNTLKYSRMFRISWKYLHFVFMCKWKDKWTSCNEGLFVCQGYVFPSFNCSYSRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,703.836 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28460 | ||
| Instability index: | 48.920 | ||
| aromaticity | 0.186 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.257 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489274.1 | internal | 126 | 1-378(+) |
Amino Acid sequence : | |||
| VSNCYWNWGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSAT LFNKGS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,703.836 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28460 | ||
| Instability index: | 48.920 | ||
| aromaticity | 0.186 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.257 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489274.1 | 5prime_partial | 113 | 378-37(-) |
Amino Acid sequence : | |||
| RPFIEKGSRINCNFLPHIPVRMFQCISNFHFFQLFNRPISECPSRCRQNNASECTLWQTLNTLKYSRMFRISWKYLHFVFMCKWKDKWTSCNEGLFVCQGYVFPSFNCSYSRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,703.836 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28460 | ||
| Instability index: | 48.920 | ||
| aromaticity | 0.186 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.257 | ||
| sheet | 0.142 | ||