| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489279.1 | 3prime_partial | 175 | 1-525(+) |
Amino Acid sequence : | |||
| MGKSSPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRE DKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGF | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 13,243.977 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.230 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489279.1 | 3prime_partial | 116 | 348-1(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRARLPH | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,243.977 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.230 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489279.1 | 3prime_partial | 175 | 1-525(+) |
Amino Acid sequence : | |||
| MGKSSPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRE DKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGF | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 13,243.977 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.230 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ489279.1 | 3prime_partial | 116 | 348-1(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRARLPH | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,243.977 | ||
| Theoretical pI: | 9.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.230 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.276 | ||