| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ888514.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| KYAESMLRPFTWGTLLMTPERRKAIWAIYVWCRRTDELVDGPNASYITPSALDRWEAKLEDLFAGRPYDMFDAALSDTVSKFPVDIQPFKDMIKGMRMDLKKSRYKNFDELYLYCYYVAG TVALMSVPVMGIAPDSQATT | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,146.524 | ||
| Theoretical pI: | 6.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 41.136 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.179 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ888514.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| KYAESMLRPFTWGTLLMTPERRKAIWAIYVWCRRTDELVDGPNASYITPSALDRWEAKLEDLFAGRPYDMFDAALSDTVSKFPVDIQPFKDMIKGMRMDLKKSRYKNFDELYLYCYYVAG TVALMSVPVMGIAPDSQATT | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,146.524 | ||
| Theoretical pI: | 6.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 41.136 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.179 | ||
| sheet | 0.279 | ||