| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ888515.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| DKPYNPGYQVAYGILAEVEEHPLDLDKMVFMDWRDSHLKGNGVMQGRNNRIPTFLYAMPFSSNRIFLEETSLVARPGLGMEDIQQRMEARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQ RVVGIGGLQEWCIPPCAIW | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,762.157 | ||
| Theoretical pI: | 5.609 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 36.876 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.252 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AJ888515.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
| DKPYNPGYQVAYGILAEVEEHPLDLDKMVFMDWRDSHLKGNGVMQGRNNRIPTFLYAMPFSSNRIFLEETSLVARPGLGMEDIQQRMEARLKHLGIKVKSIEEDERCVIPMGGPLPVLPQ RVVGIGGLQEWCIPPCAIW | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,762.157 | ||
| Theoretical pI: | 5.609 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 36.876 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.252 | ||
| sheet | 0.266 | ||