Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889506.1 | internal | 126 | 2-379(+) |
Amino Acid sequence : | |||
TRLIEYATNKVLPLILVCASGGARMQEGSLSLMQMAKISSALYTYQLNQKLFYVSILTSPTTGGVTASFGMLGDIIIAEPNAHIAFAGKRIIEQTLNVTVPEGLQEAEYSFHKGLLDFIV PRNPLK | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,716.858 | ||
Theoretical pI: | 7.799 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 44.679 | ||
aromaticity | 0.079 | ||
GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.238 | ||
sheet | 0.302 |