Acc_NO	ORF type	length	start-end position (strand +/-)
>AM889577.1	5prime_partial	142	2-430(+)
Amino Acid sequence :
FFLGFDYQGIEILQIKPEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPKIPSVFWIWRSADFQERESYDMLGISYENHPRLKRILMPES WIGWPLRKDYIAPNFYEIQDAH*
Physicochemical properties
Number of amino acids:		142
Molecular weight:		16,838.948
Theoretical pI:		5.320
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		45380 45505
Instability index:		56.080
aromaticity		0.176
GRAVY		-0.295
Secondary Structure Fraction
Helix		0.394
turn		0.218
sheet		0.197