Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889577.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
FFLGFDYQGIEILQIKPEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPKIPSVFWIWRSADFQERESYDMLGISYENHPRLKRILMPES WIGWPLRKDYIAPNFYEIQDAH* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,838.948 | ||
Theoretical pI: | 5.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45505 | ||
Instability index: | 56.080 | ||
aromaticity | 0.176 | ||
GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.218 | ||
sheet | 0.197 |