Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889770.1 | internal | 111 | 2-334(+) |
Amino Acid sequence : | |||
ESQAALDWGVSVIPECEGKIIYTDTHKIVLSGHGDTISIPLVMYQRSNKNTCMHQNPQVRRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLV | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,157.858 | ||
Theoretical pI: | 6.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 38.690 | ||
aromaticity | 0.063 | ||
GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.234 | ||
sheet | 0.243 |