Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889855.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
KPLLIMESEDNRMRDGHNKVYKSFSDVIEGKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGIAKSKIREKEPIVWEILQEVMQGHPVLL NRAPTLHRLGIQAFQPVLVEGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFS | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,614.849 | ||
Theoretical pI: | 8.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 36.440 | ||
aromaticity | 0.060 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.213 | ||
sheet | 0.284 |