Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889946.1 | internal | 161 | 1-483(+) |
Amino Acid sequence : | |||
LIGRVLADDVYIGLRCIAARNQDIGIGLVNRFITFRAQPVYIRTPFTCRSTSWICQLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHVRAPSNGKIKFN EELVHPTRTRHGHPAFICSIDLYVTVEGRDIIHNVNIPPKS | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 17,620.981 | ||
Theoretical pI: | 8.718 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 32.205 | ||
aromaticity | 0.075 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.248 | ||
sheet | 0.168 |