Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889964.1 | internal | 117 | 2-352(+) |
Amino Acid sequence : | |||
GSNPTDRSTRDQKWLRKQQDVSFVSSRRSENKEMVDIFKIITYLQNTVSIHPISSDPGCDMVPKDEPDMDSSNKISFLNKNPFFDLFHLFHDRNKGGYTLHHDFESEERFQEMADLF | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,760.112 | ||
Theoretical pI: | 5.450 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 59.712 | ||
aromaticity | 0.111 | ||
GRAVY | -0.896 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.256 | ||
sheet | 0.162 |