Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AM889982.1 | internal | 116 | 3-350(+) |
Amino Acid sequence : | |||
LEHILTHIFFSIISVVITIQLMNLLVHELVQLGDASEKGMIATFFSITGLLVTRWIYSGHFPLSDLYESLIFLSWSFSIIHMVPYFRNHRNHFSAITAPSAIFTQGFATSGLLTEM | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,161.212 | ||
Theoretical pI: | 6.126 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 34.032 | ||
aromaticity | 0.138 | ||
GRAVY | 0.685 | ||
Secondary Structure Fraction | |||
Helix | 0.440 | ||
turn | 0.216 | ||
sheet | 0.259 |