| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254724.1 | internal | 114 | 1-342(+) |
Amino Acid sequence : | |||
| QLVQMFIGDGAKLVRDAFQLAKEKSPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDDRIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQI | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,899.653 | ||
| Theoretical pI: | 5.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.589 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.158 | ||
| sheet | 0.281 | ||