Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254734.1	internal	197	2-592(+)
Amino Acid sequence :
RILIKVIKLLGSFNVGDYVPWLSWINRINGVDAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALEWTMAELIKNPRTL KTLQNEVREVSRNKGGITEDDVDKMPYLKAYPRRFYAYIPFRNSAPSRIDSRPHMLGYDIPLGTVVLVHNWGLSRDH
Physicochemical properties
Number of amino acids:		197
Molecular weight:		22,575.555
Theoretical pI:		7.046
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32430 32430
Instability index:		30.514
aromaticity		0.091
GRAVY		-0.408
Secondary Structure Fraction
Helix		0.335
turn		0.208
sheet		0.218