Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254735.1 | internal | 159 | 479-3(-) |
Amino Acid sequence : | |||
SIQNLHLMDSSPKAGNTTTSTLVNKIKFFLPMVIGKNFHVHLFKILINSGVMDDFISQPNVLRRKLLSSFISNLDRSLDPPAKSIRFSKLHCNIPPCVLITVFLQCLYNVTCKLLAHLLE SLLLMPKPLPIVILTPRQVMTENLRVELAGFSGNGGGRR | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,027.050 | ||
Theoretical pI: | 5.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 39.955 | ||
aromaticity | 0.108 | ||
GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.234 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254735.1 | 5prime_partial | 158 | 3-479(+) |
Amino Acid sequence : | |||
ASSSAVAAESGEFDAKVFRHNLTRSKNYNRKGFGHKEETLEQMSQEFTSDIVKTLKENGYQYTWGNVTVKLAESYGFCWGVERTVQIAYEARKQFPSENIWLTNEVIHNPTVNENLEEMN VKILPNNHGKKEFDLVYQGGCCGIACLWTAVHEMKILN* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 18,027.050 | ||
Theoretical pI: | 5.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 39.955 | ||
aromaticity | 0.108 | ||
GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.234 | ||
sheet | 0.253 |