| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254751.1 | 3prime_partial | 163 | 41-529(+) |
Amino Acid sequence : | |||
| MPGGGSTSGARASVRIVVIGDRGTGKSSLIAASAAESFRPEVPPVLPPTRLPSDYYPDNVPIIIIDTSSSLEYRGKLAEELKRADAVVLTYACDQPLTLNRLSTFWLHELRRLEIRAPVI VAGCKLDRGDEEYNLSVEMMPLMHSFGRLRLASNVLLLTCSKS | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,784.349 | ||
| Theoretical pI: | 7.720 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 50.931 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.270 | ||
| sheet | 0.294 | ||