| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254752.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
| LNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYD VMKEERRQRYTLSSTIVGGFGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,820.893 | ||
| Theoretical pI: | 4.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 47.701 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.162 | ||
| sheet | 0.239 | ||