| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254754.1 | internal | 202 | 3-608(+) |
Amino Acid sequence : | |||
| RERKWCMKTRKKVCVTGGTGFLGSWMIKRLLEDGYYVNATVRLDPERKRNISYITDLPGAAERLQIFNADLDKPETFAPAVERCGGVFHMAHPLDFAEKETEEVKLKRVTAAMQGILQAC ADSEDGPPNWSTPPASPPSPSATAANPGGTIDKNSWNDFNSSQPPGVRRGVHLTKTWPKRRHNLPESPARFFQYSDLVTGPS | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 11,586.970 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 96.382 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.242 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254754.1 | complete | 99 | 251-550(+) |
Amino Acid sequence : | |||
| MRRRLPHGPPTRLRRERDRGSEAEARHRRDARHSAGLRRLRRRSAELVYTSSISAVAFSNRRQPRGDHRQKLVERLQFIPASRRSPGRTSDKNVAEKTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,586.970 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 96.382 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.242 | ||
| sheet | 0.232 | ||