| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254759.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
| RAAAMDREWGSKPGSGGAATAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKEAPAQPQPHKRKVNLKKIVKIGRPGYR VTKQFDPETKQKITTFPDRISRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 12,407.485 | ||
| Theoretical pI: | 9.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 35.008 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.268 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254759.1 | complete | 112 | 464-126(-) |
Amino Acid sequence : | |||
| MNRCLGFVLSSISGYSIWKSSDLLFSLWVELLGHTISRPANFNNFFEINFALVRLRLGRSFFGLTSCSLSQVGLVTLPLCMRQVIPLVVVQSQAELTLVTSKVVAHEIGIFG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,407.485 | ||
| Theoretical pI: | 9.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 35.008 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.696 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.268 | ||
| sheet | 0.250 | ||