Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254766.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
SKDAPMFVVGVNEKEYKPEYDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVD LTVRLEKEATYEEIKAAIKEESENNLQGILGYTENDVVSTDFVGDSRSSIFDAKAGIALSKNFLKLSLGMTRMGIHSRVVDLIFHGSVA | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 11,469.388 | ||
Theoretical pI: | 4.868 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 43.664 | ||
aromaticity | 0.103 | ||
GRAVY | 0.632 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.290 | ||
sheet | 0.346 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254766.1 | 3prime_partial | 107 | 321-1(-) |
Amino Acid sequence : | |||
MPVNFPFKAGSTFPTALAAPVLLGIMLNEAALPPLQSLLDGPSTVFWVAVIEWTVVMRPSTMPNLSLMTLANGARQLVVQLAFETMSYSGLYSFSFTPTTNMGASLL | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,469.388 | ||
Theoretical pI: | 4.868 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 43.664 | ||
aromaticity | 0.103 | ||
GRAVY | 0.632 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.290 | ||
sheet | 0.346 |