Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254772.1	5prime_partial	145	3-440(+)
Amino Acid sequence :
HAVKMGERSNKQIILKDYVKGFPKESDMILKTSIVKLKVPEGLNGAVLVKNLYLSCDPYMRARMEKTEGGSYIDSFTPGEAIVGFGVSKIIDSSNSDFEKGDLVWGMTGWEEYSLIKSAQ SLNKLPFAGDVSSLLLHWEFLVCLV*
Physicochemical properties
Number of amino acids:		145
Molecular weight:		16,096.476
Theoretical pI:		6.161
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 24075
Instability index:		38.354
aromaticity		0.097
GRAVY		-0.037
Secondary Structure Fraction
Helix		0.352
turn		0.262
sheet		0.255