Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254778.1 | 5prime_partial | 162 | 3-491(+) |
Amino Acid sequence : | |||
VFFSVSLILLAVLFHKRKSSLSSRKRPPPSPLRLPVIGHFHLIGALSHRSFTSLSKRYGEVMLLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHWR NARSMCMLQLLSAKKVQSFGGIREKETSAMIEKIRRSKPTTS* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,085.118 | ||
Theoretical pI: | 11.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 58.233 | ||
aromaticity | 0.086 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.265 | ||
sheet | 0.272 |