Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254781.1	5prime_partial	186	1-561(+)
Amino Acid sequence :
VGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLCDEHRLTEERVDEVVEVFLQDI KEGELEESQWAPHFAAERISKAALNAYLRLRGKNTQFPPKCHMPGLCEKRITSPRAPPFGETAQVP*
Physicochemical properties
Number of amino acids:		186
Molecular weight:		20,810.549
Theoretical pI:		5.361
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22710
Instability index:		45.280
aromaticity		0.086
GRAVY		-0.349
Secondary Structure Fraction
Helix		0.296
turn		0.231
sheet		0.317